CDS

Accession Number TCMCG083C11192
gbkey CDS
Protein Id KMZ67092.1
Location complement(join(881534..881593,881700..881786,881882..881947,882383..882505,882835..882876,882978..882980))
Organism Zostera marina
locus_tag ZOSMA_27G01470

Protein

Length 126aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA41721, BioSample:SAMN00991190
db_source LFYR01000932.1
Definition hypothetical protein ZOSMA_27G01470 [Zostera marina]
Locus_tag ZOSMA_27G01470

EGGNOG-MAPPER Annotation

COG_category O
Description ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko01002        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
KEGG_ko ko:K08675        [VIEW IN KEGG]
EC 3.4.21.53        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway -
GOs GO:0000166        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0004176        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005524        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005759        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006508        [VIEW IN EMBL-EBI]
GO:0006515        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0007005        [VIEW IN EMBL-EBI]
GO:0008144        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008233        [VIEW IN EMBL-EBI]
GO:0009056        [VIEW IN EMBL-EBI]
GO:0009057        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016462        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016817        [VIEW IN EMBL-EBI]
GO:0016818        [VIEW IN EMBL-EBI]
GO:0016887        [VIEW IN EMBL-EBI]
GO:0017076        [VIEW IN EMBL-EBI]
GO:0017111        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030163        [VIEW IN EMBL-EBI]
GO:0030554        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0032553        [VIEW IN EMBL-EBI]
GO:0032555        [VIEW IN EMBL-EBI]
GO:0032559        [VIEW IN EMBL-EBI]
GO:0035639        [VIEW IN EMBL-EBI]
GO:0036094        [VIEW IN EMBL-EBI]
GO:0042623        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044248        [VIEW IN EMBL-EBI]
GO:0044257        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044265        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0051603        [VIEW IN EMBL-EBI]
GO:0070011        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0097367        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901265        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901565        [VIEW IN EMBL-EBI]
GO:1901575        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTGAAGAGGATCCACTTACTGTAAAAGTTGATCATTTGAAGGATAAACCATTTAATAAAGATGATGATGTCATAAAAGCAACATCCTTTGAAGTTATCGAAACATTGAGGGATGTCTTGAAGTCTAGCAGTCTTTGGAGGGATCATGTCCAAACTTATACTCAGGTTTACATGCGCTTGAAACTAACTTTAGAGCTACTAAAGAAGGAAATTGAGATCACTAAGATACAAGAATCAATTGCAAAAGCAATTGAAGAAAAGATAAGTGGTGAGCAGCGTCGTTTCTTGCTGAACGAACAACTTAAAGCAATAAAAAAGGAACTTGGTGTAGAGACTGATGATAAGACAGCACTTTCAGGTCTGTATTTGAAAGTTTAG
Protein:  
MVEEDPLTVKVDHLKDKPFNKDDDVIKATSFEVIETLRDVLKSSSLWRDHVQTYTQVYMRLKLTLELLKKEIEITKIQESIAKAIEEKISGEQRRFLLNEQLKAIKKELGVETDDKTALSGLYLKV